- Recombinant Acinetobacter baumannii UPF0756 membrane protein ACICU_02320 (ACICU_02320)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1138593
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 15,395 Da
- E Coli or Yeast
- 1-150
- UPF0756 membrane protein ACICU_02320 (ACICU_02320)
Sequence
MLAQFYVNLVVLLVLLICGLLSQNAAVTIAAGVLIVIKITPLNQFFPYIQAHGLNLGILILTIGVLTPIASGKLSGESILKSFISFKSLVAIAIGLLVAWLGGRGVKLMSSQPDVVAGLLIGTVAGVALLRGVPVGPLIAAGLLSLFIGK